PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0616s0110.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 425aa    MW: 47553 Da    PI: 8.917
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0616s0110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.47e-25117160144
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                             d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  SapurV1A.0616s0110.1.p 117 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 160
                             79***************************************997 PP

2QLQ59.69.3e-214882236
                     QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                            +FTa+Q+q+L++Q+l+yKy++++ P+Pp+Ll+ i+
  SapurV1A.0616s0110.1.p 48 PFTASQWQELEHQALIYKYMVSGIPIPPDLLFTIK 82
                            8******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.1E-124783IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-154881IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.7414883IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.888117161IPR014977WRC domain
PfamPF088792.3E-20118160IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MYRRFCRPMV PEINIPTLLS KPFSVHNNTH SLSTPHGDMI MSGGNRFPFT ASQWQELEHQ  60
ALIYKYMVSG IPIPPDLLFT IKRSGCLDSS LSSKLFPRQP PHFSWSCFQM GLGRKIDPEP  120
GRCRRTDGKK WRCSKEAYPD SKYCEKHMHR GKNRSRKPVE VATQSTTAPN VSSITRNHSN  180
NSLLTTSSHS LSLLLPETHH QNHLHYPAPS GYHAHPNHQF LSSSRPLGIG LSPHENSTHL  240
LLDSGGPSLS NTDYRRNRNV YGLKEEVDEH AFFSESSGSM RSLSGSSLDD ASQLSPLTMN  300
SSPSNTNSSK QRSLSGLHNE YSYLQLQSLS DHDTPKQQKQ YQHSYLLGSS NIGSLGPIEM  360
EKEKSQKTVH RFFDEWPPEN KDSWLDLADK SSNSASVSTT GLSMSIPSSH DFLPIFSSRT  420
NNDG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00263DAPTransfer from AT2G06200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1826621e-132AC182662.2 Populus trichocarpa clone Pop1-15O24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011045983.10.0PREDICTED: growth-regulating factor 1 isoform X2
TrEMBLU5GAT50.0U5GAT5_POPTR; Uncharacterized protein
STRINGPOPTR_0006s14560.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40433459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.17e-57growth-regulating factor 5